RARRES1 Antibody

Uniprot: P49788

Gene Name: RARRES1

Immunogen: Recombinant human RARRES1

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 33%

Core Sequence: DAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTE

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 33%, Rat - 33%, Pig - 77%, Cynomolgus monkey - 95%

Alternative gene names: PEIG1；TIG1

Alternative protein names: Retinoic acid receptor responder protein 1; Phorbol ester-induced gene 1 protein; PERG-1; RAR-responsive protein TIG1; Tazarotene-induced gene 1 protein

Protein name: Retinoic acid receptor responder 1

Clone No.: K94033_15A1

Antigen Species: Human

Target Name: RARRES1

IHC Verification: succeed

IHC Dilution: 1:500

WB Verification: Fail (Rat Liver)

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-1571

Cross reactivity: Not tested

• Artikelnummer: ASBKC-1739-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-1739-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG2b
• Human Gene ID: 5918
• Wirt: Mouse
• Konjugat: Unconjugated