RASGEF1A Antibody - N-terminal region : HRP

RASGEF1A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55468_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGEF1A

Key Reference: Burzynski,G.M., (2005) Am. J. Hum. Genet. 76 (5), 850-858

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-GEF domain-containing family member 1A

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55468_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55468_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221002
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×