RASGEF1C Antibody - middle region : Biotin

RASGEF1C Antibody - middle region : Biotin
Artikelnummer
AVIARP55737_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASGEF1C

Key Reference: Bonaldo,M.F., (1996) Genome Res. 6 (9), 791-806

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-GEF domain-containing family member 1C

Protein Size: 466

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55737_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55737_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255426
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×