RASGRF1 Antibody - N-terminal region : FITC

RASGRF1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56516_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1

Key Reference: Iguchi,T., (2007) Int. J. Oncol. 31 (2), 285-291

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-specific guanine nucleotide-releasing factor 1

Protein Size: 489

Purification: Affinity Purified

Specificity#: Predicted to recognized both human RASGRF1 isoforms (145, 55kD)
Mehr Informationen
Artikelnummer AVIARP56516_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56516_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5923
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×