RASSF7 Antibody - middle region : Biotin

RASSF7 Antibody - middle region : Biotin
Artikelnummer
AVIARP58122_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASSF7

Key Reference: Sherwood,V., (2008) Mol. Biol. Cell 19 (4), 1772-1782

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras association domain-containing protein 7

Protein Size: 373

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58122_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58122_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8045
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×