RASSF7 Antibody - middle region : HRP

RASSF7 Antibody - middle region : HRP
Artikelnummer
AVIARP58122_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASSF7

Key Reference: Sherwood,V., (2008) Mol. Biol. Cell 19 (4), 1772-1782

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras association domain-containing protein 7

Protein Size: 373

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58122_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58122_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8045
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×