RB1 Antibody - N-terminal region : FITC

RB1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58065_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RB1

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Retinoblastoma-associated protein

Protein Size: 928

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58065_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58065_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5925
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×