RBBP4 Antibody - N-terminal region : Biotin

RBBP4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56648_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. It is part of the Mi-2 complex which

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP4

Key Reference: Scuto,A., (2007) Cancer Res. 67 (21), 10317-10324

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone-binding protein RBBP4

Protein Size: 425

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56648_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56648_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5928
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×