RCAN1 Antibody - N-terminal region : FITC

RCAN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57857_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RCAN1

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcipressin-1

Protein Size: 252

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57857_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57857_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 1827
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×