RCC2 Antibody - middle region : FITC

RCC2 Antibody - middle region : FITC
Artikelnummer
AVIARP57290_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RCC2

Protein Size: 522

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57290_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57290_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunoprecipitation, Western Blotting
Human Gene ID 55920
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×