RD3 Antibody - N-terminal region : FITC

RD3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55856_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RD3

Protein Size: 195

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55856_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55856_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 343035
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×