RD3 Antibody - N-terminal region : HRP

RD3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55856_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein RD3

Protein Size: 195

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55856_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55856_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 343035
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×