Recombinant Bovine ATP synthase subunit g, mitochondrial (ATP5MG)

Recombinant Bovine ATP synthase subunit g, mitochondrial (ATP5MG)
Artikelnummer
CSB-EP635709BO-100
Verpackungseinheit
100 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: Q28852

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 18.7 kDa

Gene Names: ATP5MG

Organism: Bos taurus (Bovine)

Source: E.coli

Expression Region: 2-103aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV

Endotoxin: Not test.

Relevance: Mitochondrial membrane ATP synthase produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane.

Reference: "Association of two proteolipids of unknown function with ATP synthase from bovine heart mitochondria."Chen R., Runswick M.J., Carroll J., Fearnley I.M., Walker J.E.FEBS Lett. 581:3145-3148(2007)
Mehr Informationen
Artikelnummer CSB-EP635709BO-100
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP635709BO-100
Verpackungseinheit 100 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download