Recombinant Enterobacteria phage lambda Holin (S), partial

Recombinant Enterobacteria phage lambda Holin (S), partial
Artikelnummer
CSB-EP361129FSF-20
Verpackungseinheit
20 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: P03705

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-GST-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 35.6 kDa

Gene Names: S

Organism: Escherichia phage lambda (Bacteriophage lambda)

Source: E.coli

Expression Region: 1-37aa

Protein Length: Partial

Target Protein Sequence: MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYN

Endotoxin: Not test.

Relevance: [Isoform Holin]: Accumulates harmlessly in the cytoplasmic membrane until it reaches a critical concentration that triggers the formation of micron-scale pores (holes) causing host cell membrane disruption and endolysin escape into the periplasmic space. Determines the precise timing of host cell lysis. Participates with the endolysin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles from the host cell. ; [Isoform Antiholin]: Counteracts the aggregation of the holin molecules and thus of pore formation.
Mehr Informationen
Artikelnummer CSB-EP361129FSF-20
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP361129FSF-20
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download