Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)
Artikelnummer
CSB-EP366179EDZE1-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Others

Uniprot: P04537

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: Tag-Free

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 15.8 kDa

Gene Names: uvsY

Organism: Enterobacteria phage T4 (Bacteriophage T4)

Source: E.coli

Expression Region: 1-137aa

Protein Length: Full Length

Target Protein Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Endotoxin: Not test.

Relevance: Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA.

Reference: "Two bacteriophage T4 base plate genes (25 and 26) and the DNA repair gene uvsY belong to spatially and temporally overlapping transcription units."Gruidl M.E., Chen T.C., Gargano S., Storlazzi A., Cascino A., Mosig G.Virology 184:359-369(1991)
Mehr Informationen
Artikelnummer CSB-EP366179EDZE1-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP366179EDZE1-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download