Recombinant Human ADM Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35318

Gene Name: ADM

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Arg31

End Site: Lys140

Coverage: 0.68

Isoelectric Point: 11

Core Sequence: RKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 73%, Pig - 91%

Alternative gene names: AM

Alternative protein names: Pro-adrenomedullin [Cleaved into: Adrenomedullin; AM; Proadrenomedullin N-20 terminal peptide; ProAM N-terminal 20 peptide; PAMP; ProAM-N20]

Protein name: adrenomedullin

Full length: 185 amino acids

Entry name: ADML_HUMAN

• Artikelnummer: ASBPP-3756-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3756-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 133