Recombinant Human AFM Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P43652

Gene Name: AFM

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Asn31

End Site: Thr210

Coverage: 0.32

Isoelectric Point: 5.5

Core Sequence: NFNSTQKFIEDNIEYITIIAFAQYVQEATFEEMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPVT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 67%, Pig - 72%, Cynomolgus monkey - 93%

Alternative gene names: ALB2; ALBA

Alternative protein names: Afamin; Alpha-albumin; Alpha-Alb

Protein name: afamin

Full length: 599 amino acids

Entry name: AFAM_HUMAN

• Artikelnummer: ASBPP-3661-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3661-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 173