Recombinant Human AGRP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O00253

Gene Name: AGRP

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Ser83

End Site: Thr132

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: AGRT; ART

Alternative protein names: Agouti-related protein

Protein name: agouti related neuropeptide

Full length: 132 amino acids

Entry name: AGRP_HUMAN

• Artikelnummer: ASBPP-3182-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3182-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 181