Recombinant Human AMER2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N7J2

Gene Name: AMER2

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Glu391

End Site: Ser650

Coverage: 0.40

Isoelectric Point: 5.5

Core Sequence: EAGPSCDKHVPGPGKPALSKKNPGVVAYQGGGEEMASPDEVDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQEGVPNSDEGYWDSTTPGPEEDSSSSGKKAGIPRDSYSGDALYDLYADPDGSPATLPGGKDNEETSSLSRLKPVSPGTITCPLRTPGSLLKDSKIPISIKHLTNLPSSHPVVHQQPSRSEMPRTKIPVSKVLVRRVS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Pig - 78%, Cynomolgus monkey - 97%

Alternative gene names: FAM123A

Alternative protein names: APC membrane recruitment protein 2; Amer2; Protein FAM123A

Protein name: APC membrane recruitment protein 2

Full length: 671 amino acids

Entry name: AMER2_HUMAN

• Artikelnummer: ASBPP-4271-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4271-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 219287