Recombinant Human ANO7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6IWH7

Gene Name: ANO7

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Gln61

End Site: Gln330

Coverage: 0.29

Isoelectric Point: 7

Core Sequence: QEEDSTVLIDVSPPEAEKRGSYGSTAHASEPGGQQAAACRAGSPAKPRIADFVLVWEEDLKLDRQQDSAARDRTDMHRTWRETFLDNLRAAGLCVDQQDVQDGNTTVHYALLSASWAVLCYYAEDLRLKLPLQELPNQASNWSAGLLAWLGIPNVLLEVVPDVPPEYYSCRFRVNKLPRFLGSDNQDTFFTSTKRHQILFEILAKTPYGHEKKNLLGIHQLLAEGVLSAAFPLHDGPFKTPPEGPQAPRLNQRQVLFQHWARWGKWNKYQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 73%, Pig - 34%, Cynomolgus monkey - 92%

Alternative gene names: NGEP; PCANAP5; TMEM16G

Alternative protein names: Anoctamin-7; Dresden transmembrane protein of the prostate; D-TMPP; IPCA-5; New gene expressed in prostate; Prostate cancer-associated protein 5; Transmembrane protein 16G

Protein name: anoctamin 7

Full length: 933 amino acids

Entry name: ANO7_HUMAN

• Artikelnummer: ASBPP-3808-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3808-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 50636