Recombinant Human ANXA11 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P50995

Gene Name: ANXA11

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Asp291

End Site: Asn370

Coverage: 0.17

Isoelectric Point: 6

Core Sequence: DEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGEN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 57%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: ANX11

Alternative protein names: Annexin A11; 56 kDa autoantigen; Annexin XI; Annexin-11; Calcyclin-associated annexin 50; CAP-50

Protein name: annexin A11

Full length: 505 amino acids

Entry name: ANX11_HUMAN

Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers

• Artikelnummer: ASBPP-308-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-308-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 311