Recombinant Human APRT Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P07741

Gene Name: APRT

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Met1

End Site: Glu180

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 87%, Pig - 87%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Adenine phosphoribosyltransferase; APRT

Protein name: adenine phosphoribosyltransferase

Full length: 180 amino acids

Entry name: APT_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-3930-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3930-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 353