Recombinant Human ARHGDIG Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q99819

Gene Name: ARHGDIG

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Glu31

End Site: Cys220

Coverage: 0.88

Isoelectric Point: 6.5

Core Sequence: EGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCIC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 61%, Pig - 84%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Rho GDP-dissociation inhibitor 3; Rho GDI 3; Rho-GDI gamma

Protein name: Rho GDP dissociation inhibitor gamma

Full length: 225 amino acids

Entry name: GDIR3_HUMAN

• Artikelnummer: ASBPP-371-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-371-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 398