Recombinant Human SERCA1 ATPase Protein

Recombinant Human SERCA1 ATPase Protein
Artikelnummer
ASBPP-4244-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: O14983

Gene Name: ATP2A1

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Arg651

End Site: Phe740

Coverage: 0.09

Isoelectric Point: 5

Core Sequence: RAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLADDNF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 100%, Pig - 98%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA1; SR Ca(2+)-ATPase 1; Calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum type; fast twitch skeletal muscle isoform; Endoplasmic reticulum class 1/2 Ca(2+) ATPase

Protein name: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1

Full length: 1001 amino acids

Entry name: AT2A1_HUMAN

Product panel: Enzyme
Mehr Informationen
Artikelnummer ASBPP-4244-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4244-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 487
Produktinformation (PDF)
×
MSDS (PDF)
×