Recombinant Human BMP10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95393

Gene Name: BMP10

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asn317

End Site: Arg424

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: NAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%

Alternative gene names: /

Alternative protein names: Bone morphogenetic protein 10; BMP-10

Protein name: bone morphogenetic protein 10

Full length: 424 amino acids

Entry name: BMP10_HUMAN

Product panel: Cytokines

• Artikelnummer: ASBPP-3783-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3783-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 27302