Recombinant Human BMS1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14692

Gene Name: BMS1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Val791

End Site: Phe880

Coverage: 0.07

Isoelectric Point: 4.5

Core Sequence: VHKGKSGPNTQNEDIEKEVKEEIDPDEEESAKKKHLDKKRKLKEMFDAEYDEGESTYFDDLKGEMQKQAQLNRAEFEDQDDEARVQYEGF

Homologies: Highest protein sequence identity to the following orthologs: Pig - 89%, Cynomolgus monkey - 100%

Alternative gene names: BMS1L; KIAA0187

Alternative protein names: Ribosome biogenesis protein BMS1 homolog; Ribosome assembly protein BMS1 homolog

Protein name: BMS1 ribosome biogenesis factor

Full length: 1282 amino acids

Entry name: BMS1_HUMAN

• Artikelnummer: ASBPP-10417-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10417-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 9790