Recombinant Human BOLA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H3K6

Gene Name: BOLA2B,BOLA2

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Met1

End Site: Lys86

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%

Alternative gene names: BOLA2A

Alternative protein names: BolA-like protein 2

Protein name: bolA family member 2B,bolA family member 2

Full length: 86 amino acids

Entry name: BOLA2_HUMAN

• Artikelnummer: ASBPP-3990-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3990-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 654483