Recombinant Human BTC Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35070

Gene Name: BTC

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Thr41

End Site: Phe110

Coverage: 0.59

Isoelectric Point: 7

Core Sequence: TNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 47%, Pig - 88%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Probetacellulin [Cleaved into: Betacellulin; BTC]

Protein name: betacellulin

Full length: 178 amino acids

Entry name: BTC_HUMAN

• Artikelnummer: ASBPP-3090-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3090-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 685