Research Areas: Immunology
Uniprot: P22362
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 10xHis-HA-tagged
Purity: Greater than 95% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 12.3 kDa
Gene Names: CCL1
Organism: Homo sapiens (Human)
Source: Mammalian cell
Expression Region: 24-96aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Endotoxin: Not test.
Relevance: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.