Note: Dry Ice fees will be extra-charged
Uniprot: P0C0L5
Gene Name: C4B,C4B_2
Expression System: Escherichia coli
Molecular Weight: 14 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 77%
Start Site: Leu1331
End Site: Asp1430
Coverage: 0.06
Isoelectric Point: 4.5
Core Sequence: LSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDD
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 82%, Pig - 81%, Cynomolgus monkey - 96%
Alternative gene names: CO4; CPAMD3
Alternative protein names: Complement C4-B; Basic complement C4; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3) [Cleaved into: Complement C4 beta chain; Complement C4-B alpha chain; C4a anaphylatoxin; C4b-B; C4d-B; Complement C4 gamma chain]
Protein name: complement C4B (Chido/Rodgers blood group),complement component 4B (Chido/Rodgers blood group), copy 2
Full length: 1744 amino acids
Entry name: CO4B_HUMAN
Deutsch
English
