Recombinant Human Calpain Small Subunit 1 Protein

Recombinant Human Calpain Small Subunit 1 Protein
Artikelnummer
ASBPP-4292-100
Verpackungseinheit
100 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: P04632

Gene Name: CAPNS1

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu91

End Site: Glu260

Coverage: 0.68

Isoelectric Point: 5.5

Core Sequence: EANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 92%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: CAPN4; CAPNS

Alternative protein names: Calpain small subunit 1; CSS1; Calcium-activated neutral proteinase small subunit; CANP small subunit; Calcium-dependent protease small subunit; CDPS; Calcium-dependent protease small subunit 1; Calpain regulatory subunit

Protein name: calpain small subunit 1

Full length: 268 amino acids

Entry name: CPNS1_HUMAN
Mehr Informationen
Artikelnummer ASBPP-4292-100
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-4292-100
Verpackungseinheit 100 μg
Mengeneinheit STK
Human Gene ID 826
Produktinformation (PDF)
×
MSDS (PDF)
×