Recombinant Human CCL15 Protein

Recombinant Human CCL15 Protein
Artikelnummer
ASBPP-3809-20
Verpackungseinheit
20 μg
Hersteller
Absea Biotechnology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Note: Dry Ice fees will be extra-charged

Uniprot: Q16663

Gene Name: CCL15

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 40%

Start Site: Gln22

End Site: Ile113

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 40%, Rat - 48%, Pig - 50%, Cynomolgus monkey - 88%

Alternative gene names: MIP5; NCC3; SCYA15

Alternative protein names: C-C motif chemokine 15; Chemokine CC-2; HCC-2; Leukotactin-1; LKN-1; MIP-1 delta; Macrophage inflammatory protein 5; MIP-5; Mrp-2b; NCC-3; Small-inducible cytokine A15) [Cleaved into: CCL15(22-92; CCL15(25-92; CCL15(29-92]

Protein name: C-C motif chemokine ligand 15

Full length: 113 amino acids

Entry name: CCL15_HUMAN

Product panel: Cytokines
Mehr Informationen
Artikelnummer ASBPP-3809-20
Hersteller Absea Biotechnology
Hersteller Artikelnummer PP-3809-20
Verpackungseinheit 20 μg
Mengeneinheit STK
Human Gene ID 6359
Produktinformation (PDF)
×
MSDS (PDF)
×