Recombinant Human CCL16 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15467

Gene Name: CCL16

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 43%

Start Site: Val51

End Site: Gln120

Coverage: 0.82

Isoelectric Point: 10

Core Sequence: VVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 43%, Rat - 42%, Pig - 70%, Cynomolgus monkey - 88%

Alternative gene names: ILINCK; NCC4; SCYA16

Alternative protein names: C-C motif chemokine 16; Chemokine CC-4; HCC-4; Chemokine LEC; IL-10-inducible chemokine; LCC-1; Liver-expressed chemokine; Lymphocyte and monocyte chemoattractant; LMC; Monotactin-1; MTN-1; NCC-4; Small-inducible cytokine A16

Protein name: C-C motif chemokine ligand 16

Full length: 120 amino acids

Entry name: CCL16_HUMAN

Product panel: Cytokines

• Artikelnummer: ASBPP-3668-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3668-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 6360