Recombinant Human CCL17 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92583

Gene Name: CCL17

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Ala24

End Site: Ser94

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 67%, Pig - 77%, Cynomolgus monkey - 90%

Alternative gene names: SCYA17; TARC

Alternative protein names: C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine

Protein name: C-C motif chemokine ligand 17

Full length: 94 amino acids

Entry name: CCL17_HUMAN

• Artikelnummer: ASBPP-3149-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3149-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 6361