Recombinant Human CCNL1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UK58

Gene Name: CCNL1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Ile281

End Site: Arg390

Coverage: 0.23

Isoelectric Point: 10.5

Core Sequence: ICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKAKGLNPDGTPALSTLGGFSPASKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Cyclin-L1; Cyclin-L

Protein name: cyclin L1

Full length: 526 amino acids

Entry name: CCNL1_HUMAN

• Artikelnummer: ASBPP-10382-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10382-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 57018