Recombinant Human CCNL2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96S94

Gene Name: CCNL2

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Glu271

End Site: Lys450

Coverage: 0.36

Isoelectric Point: 11

Core Sequence: EEIQEICLKILQLYARKKVDLTHLEGEVEKRKHAIEEAKAQARGLLPGGTQVLDGTSGFSPAPKLVESPKEGKGSKPSPLSVKNTKRRLEGAKKAKADSPVNGLPKGRESRSRSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSRSRSRSDSPPRQAPRSAPYKGSEIRGSRKSK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 81%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Cyclin-L2; Paneth cell-enhanced expression protein

Protein name: cyclin L2

Full length: 520 amino acids

Entry name: CCNL2_HUMAN

• Artikelnummer: ASBPP-10481-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-10481-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 81669