Note: Dry Ice fees will be extra-charged
Uniprot: P25942
Gene Name: CD40
Expression System: Escherichia coli
Molecular Weight: 31.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: N-SUMO & C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 59%
Start Site: Tyr31
End Site: Asp190
Coverage: 0.67
Isoelectric Point: 5
Core Sequence: YLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 36%, Pig - 76%
Alternative gene names: TNFRSF5
Alternative protein names: Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Protein name: CD40 molecule
Full length: 277 amino acids
Entry name: TNR5_HUMAN
CD Antigen: CD40
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers,CD Antigen
Deutsch
English
