Recombinant Human CD63 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P08962-1

Gene Name: CD63

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Val111

End Site: Arg200

Coverage: 0.42

Isoelectric Point: 8.5

Core Sequence: VMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Rat - 66%, Pig - 78%, Cynomolgus monkey - 100%

Alternative gene names: MLA1; TSPAN30

Alternative protein names: CD63 antigen; Granulophysin; Lysosomal-associated membrane protein 3; LAMP-3; Lysosome integral membrane protein 1; Limp1; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30; Tspan-30; CD antigen CD63

Protein name: CD63 molecule

Full length: 238 amino acids

Entry name: CD63_HUMAN

CD Antigen: CD63

Product panel: IHC Pathology,CD Antigen

• Artikelnummer: ASBPP-3800-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3800-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK