Note: Dry Ice fees will be extra-charged
Uniprot: P09564
Gene Name: CD7
Expression System: Escherichia coli
Molecular Weight: 17.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 50%
Start Site: Gln31
End Site: Pro180
Coverage: 0.72
Isoelectric Point: 6
Core Sequence: QSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Rat - 34%, Pig - 52%, Cynomolgus monkey - 85%
Alternative gene names: /
Alternative protein names: T-cell antigen CD7; GP40; T-cell leukemia antigen; T-cell surface antigen Leu-9; TP41; CD antigen CD7
Protein name: CD7 molecule
Full length: 240 amino acids
Entry name: CD7_HUMAN
CD Antigen: CD7
Product panel: IHC Pathology,CD Antigen
Deutsch
English
