Recombinant Human CDH12 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P55289

Gene Name: CDH12

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Phe61

End Site: Thr260

Coverage: 0.29

Isoelectric Point: 4.5

Core Sequence: FFVLEEYVGSEPQYVGKLHSDLDKGEGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDREEKPFYTLRAQAVDIETRKPLEPESEFIIKVQDINDNEPKFLDGPYVATVPEMSPVGAYVLQVKATDADDPTYGNSARVVYSILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAKDMGGQLGGLAGTTIVNITLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 81%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Cadherin-12; Brain cadherin; BR-cadherin; Neural type cadherin 2; N-cadherin 2

Protein name: cadherin 12

Full length: 794 amino acids

Entry name: CAD12_HUMAN

• Artikelnummer: ASBPP-3208-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3208-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 1010