Recombinant Human CDR2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q01850

Gene Name: CDR2

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Glu11

End Site: Leu250

Coverage: 0.57

Isoelectric Point: 4.5

Core Sequence: EMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: PCD17

Alternative protein names: Cerebellar degeneration-related protein 2; Major Yo paraneoplastic antigen; Paraneoplastic cerebellar degeneration-associated antigen

Protein name: cerebellar degeneration related protein 2

Full length: 454 amino acids

Entry name: CDR2_HUMAN

Product panel: Autoimmune Disease

• Artikelnummer: ASBPP-368-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-368-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 1039