Recombinant Human CENPH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H3R5

Gene Name: CENPH

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Asp11

End Site: Gln200

Coverage: 0.82

Isoelectric Point: 5.5

Core Sequence: DEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Pig - 80%, Cynomolgus monkey - 95%

Alternative gene names: ICEN35

Alternative protein names: Centromere protein H; CENP-H; Interphase centromere complex protein 35

Protein name: centromere protein H

Full length: 247 amino acids

Entry name: CENPH_HUMAN

• Artikelnummer: ASBPP-389-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-389-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 64946