Recombinant Human CENPH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H3R5

Gene Name: CENPH

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Asp11

End Site: Thr210

Coverage: 0.88

Isoelectric Point: 6

Core Sequence: DEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 80%, Cynomolgus monkey - 95%

Alternative gene names: ICEN35

Alternative protein names: Centromere protein H; CENP-H; Interphase centromere complex protein 35

Protein name: centromere protein H

Full length: 247 amino acids

Entry name: CENPH_HUMAN

• Artikelnummer: ASBPP-387-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-387-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 64946