Recombinant Human CHRNA3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P32297

Gene Name: CHRNA3

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Arg41

End Site: Leu140

Coverage: 0.24

Isoelectric Point: 6

Core Sequence: RLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: NACHRA3

Alternative protein names: Neuronal acetylcholine receptor subunit alpha-3

Protein name: cholinergic receptor nicotinic alpha 3 subunit

Full length: 505 amino acids

Entry name: ACHA3_HUMAN

• Artikelnummer: ASBPP-4415-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4415-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 1136