Recombinant Human CINP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BW66

Gene Name: CINP

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Met1

End Site: Leu212

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Pig - 78%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Cyclin-dependent kinase 2-interacting protein; CDK2-interacting protein

Protein name: cyclin dependent kinase 2 interacting protein

Full length: 212 amino acids

Entry name: CINP_HUMAN

• Artikelnummer: ASBPP-4034-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4034-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 51550