Recombinant Human CKB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P12277

Gene Name: CKB

Expression System: Escherichia coli

Molecular Weight: 43.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Lys381

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: CKBB

Alternative protein names: Creatine kinase B-type; Brain creatine kinase; B-CK; Creatine kinase B chain; Creatine phosphokinase B-type; CPK-B

Protein name: creatine kinase B

Full length: 381 amino acids

Entry name: KCRB_HUMAN

Product panel: Enzyme

• Artikelnummer: ASBPP-4091-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4091-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 1152