Recombinant Human Cleavage and polyadenylation specificity factor subunit 4 (CPSF)

Recombinant Human Cleavage and polyadenylation specificity factor subunit 4 (CPSF)
Artikelnummer
CSB-EP005919HU-100
Verpackungseinheit
100 µg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Microbiology

Uniprot: O95639

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal GST-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 54.5 kDa

Gene Names: CPSF4

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 1-244aa

Protein Length: Full Length of Isoform 2

Target Protein Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ

Endotoxin: Not test.

Relevance: Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).

Reference: "Assignment of the human homolog of the zebrafish essential gene no arches to 7q22.1."Kawakami K., Gaiano N., Grosshans D., Scherer S., Tsui L.-C., Hopkins N.Submitted (NOV-1996)

Function: Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U).
Mehr Informationen
Artikelnummer CSB-EP005919HU-100
Hersteller Cusabio
Hersteller Artikelnummer CSB-EP005919HU-100
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human
Methode SDS-PAGE
Wirt Escherichia Coli
Produktinformation (PDF) Download
MSDS (PDF) Download