Recombinant Human CLIC5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZA1

Gene Name: CLIC5

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Asp11

End Site: Asn190

Coverage: 0.46

Isoelectric Point: 4

Core Sequence: DTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVSVYTIKGEETSLASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 80%, Pig - 56%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Chloride intracellular channel protein 5

Protein name: chloride intracellular channel 5

Full length: 410 amino acids

Entry name: CLIC5_HUMAN

• Artikelnummer: ASBPP-3997-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-3997-100
• Verpackungseinheit: 100 μg
• Mengeneinheit: STK
• Human Gene ID: 53405