Recombinant Human CNN2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q99439

Gene Name: CNN2

Expression System: Escherichia coli

Molecular Weight: 35 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Tyr309

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 65%, Pig - 96%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Calponin-2; Calponin H2; smooth muscle; Neutral calponin

Protein name: calponin 2

Full length: 309 amino acids

Entry name: CNN2_HUMAN

• Artikelnummer: ASBPP-4105-20
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: PP-4105-20
• Verpackungseinheit: 20 μg
• Mengeneinheit: STK
• Human Gene ID: 1265