Recombinant Human Complement component C8 gamma chain (C8G)

Recombinant Human Complement component C8 gamma chain (C8G)
Artikelnummer
CSB-BP004196HU-1
Verpackungseinheit
1 mg
Hersteller
Cusabio

Verfügbarkeit: wird geladen...
Preis wird geladen...
Research Areas: Immunology

Uniprot: P07360

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 22.9 kDa

Gene Names: C8G

Organism: Homo sapiens (Human)

Source: Baculovirus

Expression Region: 21-202aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Endotoxin: Not test.

Relevance: C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.

Reference: "The homology of complement factor C8 gamma chain and alpha-1-microglobulin."Hunt L.T., Elzanowski A., Barker W.C.Biochem. Biophys. Res. Commun. 149:282-288(1987)

Function: C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.
Mehr Informationen
Artikelnummer CSB-BP004196HU-1
Hersteller Cusabio
Hersteller Artikelnummer CSB-BP004196HU-1
Verpackungseinheit 1 mg
Mengeneinheit STK
Produktinformation (PDF) Download
MSDS (PDF) Download